PDB entry 2bp7

View 2bp7 on RCSB PDB site
Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)
Class: oxidoreductase
Keywords: flavoprotein, thdp cofactor, oxidoreductase
Deposited on 2005-04-18, released 2005-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7a_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7b1, d2bp7b2
  • Chain 'C':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7c_
  • Chain 'D':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7d1, d2bp7d2
  • Chain 'E':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7e_
  • Chain 'F':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7f1, d2bp7f2
  • Chain 'G':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7g_
  • Chain 'H':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bp7h1, d2bp7h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bp7A (A:)
    mneyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvlde
    qgdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqa
    lalnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagffti
    sgnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvv
    nnqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgps
    liewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattae
    feaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqelgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7A (A:)
    neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
    gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
    alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
    gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
    nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
    iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
    eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bp7B (B:)
    matttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapi
    sesgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmp
    cgggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyn
    gpfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaae
    esgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhl
    eapiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7B (B:)
    atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
    esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
    gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
    pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
    sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
    apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bp7C (C:)
    mneyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvlde
    qgdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqa
    lalnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagffti
    sgnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvv
    nnqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgps
    liewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattae
    feaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqelgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7C (C:)
    neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
    gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
    alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
    gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
    nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
    iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
    eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bp7D (D:)
    matttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapi
    sesgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmp
    cgggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyn
    gpfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaae
    esgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhl
    eapiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7D (D:)
    atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
    esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
    gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
    pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
    sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
    apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bp7E (E:)
    mneyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvlde
    qgdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqa
    lalnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagffti
    sgnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvv
    nnqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgps
    liewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattae
    feaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqelgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7E (E:)
    neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
    gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
    alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
    gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
    nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
    iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
    eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bp7F (F:)
    matttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapi
    sesgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmp
    cgggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyn
    gpfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaae
    esgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhl
    eapiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7F (F:)
    atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
    esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
    gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
    pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
    sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
    apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bp7G (G:)
    mneyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvlde
    qgdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqa
    lalnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagffti
    sgnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvv
    nnqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgps
    liewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattae
    feaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqelgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7G (G:)
    neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
    gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
    alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
    gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
    nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
    iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
    eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bp7H (H:)
    matttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapi
    sesgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmp
    cgggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyn
    gpfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaae
    esgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhl
    eapiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp7H (H:)
    atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
    esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
    gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
    pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
    sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
    apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev