PDB entry 2bp6

View 2bp6 on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
Class: lectin
Keywords: lectin,galactose,calcium,pseudomonas aeruginosa
Deposited on 2005-04-18, released 2006-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.14346
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bp6a1
  • Chain 'B':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bp6b1
  • Chain 'C':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bp6c1
  • Chain 'D':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bp6d1
  • Heterogens: GXL, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bp6A (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bp6B (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bp6C (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bp6D (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg