PDB entry 2bp3

View 2bp3 on RCSB PDB site
Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
Class: structural protein
Keywords: structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex
Deposited on 2005-04-18, released 2005-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BP3 (Start-2)
    • Uniprot P21333 (3-End)
    Domains in SCOPe 2.08: d2bp3a1
  • Chain 'B':
    Compound: Filamin A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bp3b_
  • Chain 'S':
    Compound: platelet glycoprotein ib alpha chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: platelet glycoprotein ib alpha chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bp3A (A:)
    gamvncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgt
    csvsylpvlpgdysilvkyneqhvpgspftarvtgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp3A (A:)
    mvnchvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsv
    sylpvlpgdysilvkyneqhvpgspftarvtgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bp3B (B:)
    gamvncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgt
    csvsylpvlpgdysilvkyneqhvpgspftarvtgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bp3B (B:)
    cghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvsy
    lpvlpgdysilvkyneqhvpgspftarvtgd
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.