PDB entry 2boy

View 2boy on RCSB PDB site
Description: crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp
Class: oxidoreductase
Keywords: beta barrel, oxidoreductase, dioxygenase
Deposited on 2005-04-15, released 2006-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boya_
  • Chain 'B':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyb_
  • Chain 'C':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyc_
  • Chain 'D':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyd_
  • Chain 'E':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (0-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boye_
  • Chain 'F':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyf_
  • Chain 'G':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (0-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyg_
  • Chain 'H':
    Compound: 3-chlorocatechol 1,2-dioxygenase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L3 (Start-253)
      • conflict (43)
    Domains in SCOPe 2.06: d2boyh_
  • Heterogens: FE, BHO, LPP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2boyA (A:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyA (A:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsgp
    hfetsykftlgkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2boyB (B:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyB (B:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqgph
    fetsykftlgkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2boyC (C:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyC (C:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieagphf
    etsykftlgkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2boyD (D:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyD (D:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieagphf
    etsykftlgkv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2boyE (E:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyE (E:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieagph
    fetsykftlgkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2boyF (F:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyF (F:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkiphfets
    ykftlgkv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2boyG (G:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyG (G:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaphf
    etsykftlgkv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2boyH (H:)
    mstdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaie
    svaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladv
    lldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgalla
    aagwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsg
    phfetsykftlgkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2boyH (H:)
    stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies
    vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl
    ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa
    agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkiphfets
    ykftlgkv