PDB entry 2bop

View 2bop on RCSB PDB site
Description: crystal structure at 1.7 angstroms of the bovine papillomavirus-1 e2 DNA-binding domain bound to its DNA target
Class: transcription/DNA
Keywords: protein-DNA complex, double helix
Deposited on 1994-01-13, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.2007
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (e2)
    Species: Bovine papillomavirus type 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bopa_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*gp*ap*cp*cp*gp*ap*cp*gp*tp*cp*gp*gp*tp*cp*g )-3')
  • Heterogens: YB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bopA (A:)
    scfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgspsq
    rqdflkhvplppgmnisgftasldf
    

  • Chain 'B':
    No sequence available.