PDB entry 2bod

View 2bod on RCSB PDB site
Description: catalytic domain of endo-1,4-glucanase cel6a from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside
Class: hydrolase
Keywords: endoglucanase, thermobifida fusca, tim a/b fold, glycoside hydrolase family 6, methyl cellobiosyl-4-thio-beta-cellobioside, carbohydrate metabolism, cellulose degradation, glycosidase, hydrolase, polysaccharide degradation
Deposited on 2005-04-10, released 2005-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1862
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: endoglucanase e-2
    Species: THERMOMONOSPORA FUSCA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bodx1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bodX (X:)
    ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
    aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
    lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
    ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
    tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bodX (X:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsaa
    qaagkipilvvynapgrdcgapshsayrswidefaaglknrpayiivepdlislmsscmq
    hvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisnsahgiatn
    tsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraigtpsttnt
    gdpmidaflwiklpgeadgciagagqfvpqaayemaiaa