PDB entry 2bob

View 2bob on RCSB PDB site
Description: potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Class: immune system/transport protein
Keywords: immune system/transport protein, complex (antibody/ion channel), potassium channel, ion transport, ionic channel, protein- antibody fab complex
Deposited on 2005-04-09, released 2005-04-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BOB (0-211)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
  • Chain 'C':
    Compound: potassium channel kcsa
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered mutation (89)
    Domains in SCOPe 2.01: d2bobc1
  • Heterogens: TL, CO, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2bobC (C:)
mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrgh

    Sequence, based on observed residues (ATOM records): (download) 
    >2bobC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh