PDB entry 2bob

View 2bob on RCSB PDB site
Description: potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Class: complex (antibody/ion channel)
Keywords: potassium channel, ion transport, ionic channel, protein-antibody fab complex
Deposited on 2005-04-09, released 2005-04-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.22182
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BOB (0-211)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: MUS MUSCULUS
  • Chain 'C':
    Compound: potassium channel kcsa
    Species: Streptomyces lividans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered mutation (89)
    Domains in SCOP 1.73: d2bobc1
  • Heterogens: CO, TL, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bobC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bobC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh