PDB entry 2boa

View 2boa on RCSB PDB site
Description: human procarboxypeptidase a4.
Class: hydrolase
Keywords: metalloprocarboxypeptidase, x-ray crystal structure, zymogen, metalloprotease, exopropeptidase, hydrolase, carboxypeptidase
Deposited on 2005-04-08, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BOA (0-0)
    • Uniprot Q9UI42 (94-403)
    Domains in SCOP 1.73: d2boaa1, d2boaa2
  • Chain 'B':
    Compound: carboxypeptidase a4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BOA (0-0)
    • Uniprot Q9UI42 (94-403)
    Domains in SCOP 1.73: d2boab1, d2boab2
  • Heterogens: NAG, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2boaA (A:)
    rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
    sflrsqgleyavtiedlqalldneddemqhnegqerssnnfnygayhsleaiyhemdnia
    adfpdlarrvkighsfenrpmyvlkfstgkgvrrpavwlnagihsrewisqataiwtark
    ivsdyqrdpaitsilekmdifllpvanpdgyvytqtqnrlwrktrsrnpgsscigadpnr
    nwnasfagkgasdnpcsevyhgphansevevksvvdfiqkhgnfkgfidlhsysqllmyp
    ygysvkkapdaeeldkvarlaakalasvsgteyqvgptcttvypasgssidwaydngikf
    aftfelrdtgtygfllpanqiiptaeetwlglktimehvrdnly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2boaB (B:)
    rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
    sflrsqgleyavtiedlqalldneddemqhnegqerssnnfnygayhsleaiyhemdnia
    adfpdlarrvkighsfenrpmyvlkfstgkgvrrpavwlnagihsrewisqataiwtark
    ivsdyqrdpaitsilekmdifllpvanpdgyvytqtqnrlwrktrsrnpgsscigadpnr
    nwnasfagkgasdnpcsevyhgphansevevksvvdfiqkhgnfkgfidlhsysqllmyp
    ygysvkkapdaeeldkvarlaakalasvsgteyqvgptcttvypasgssidwaydngikf
    aftfelrdtgtygfllpanqiiptaeetwlglktimehvrdnly