PDB entry 2bo9

View 2bo9 on RCSB PDB site
Description: Human carboxypeptidase A4 in complex with human latexin.
Class: hydrolase
Keywords: metallocarboxypeptidase, x-ray crystal structure, endogenous protein inhibitor, latexin, metalloprotease carboxypeptidase, hydrolase
Deposited on 2005-04-08, released 2005-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bo9a1
  • Chain 'B':
    Compound: human latexin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bo9b1, d2bo9b2
  • Chain 'C':
    Compound: carboxypeptidase a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bo9c_
  • Chain 'D':
    Compound: human latexin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bo9d1, d2bo9d2
  • Heterogens: NAG, ZN, VAL, MPD, ACN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bo9A (A:)
    ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
    vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
    qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
    fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
    ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
    ehvrdnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo9A (A:)
    ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
    vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
    qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
    fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
    ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
    ehvrdnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bo9B (B:)
    meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
    iiqkqvkvnctaevlypstgqetapevnftfegetgknpdeedntfyqrlksmkepleaq
    nipdnfgnvspemtlvlhlawvacgyiiwqnstedtwykmvkiqtvkqvqrnddfieldy
    tillhniasqeiipwqmqvlwhpqygtkvkhnsrlpkevqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo9B (B:)
    meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
    iiqkqvkvnctaevlypstgqetapevnftfegetgknpdeedntfyqrlksmkepleaq
    nipdnfgnvspemtlvlhlawvacgyiiwqnstedtwykmvkiqtvkqvqrnddfieldy
    tillhniasqeiipwqmqvlwhpqygtkvkhnsrlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bo9C (C:)
    ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
    vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
    qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
    fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
    ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
    ehvrdnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo9C (C:)
    ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
    vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
    qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
    fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
    ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
    ehvrdnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bo9D (D:)
    meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
    iiqkqvkvnctaevlypstgqetapevnftfegetgknpdeedntfyqrlksmkepleaq
    nipdnfgnvspemtlvlhlawvacgyiiwqnstedtwykmvkiqtvkqvqrnddfieldy
    tillhniasqeiipwqmqvlwhpqygtkvkhnsrlpkevqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo9D (D:)
    meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
    iiqkqvkvnctaevlypstgqetapevnftfegetgknpdeedntfyqrlksmkepleaq
    nipdnfgnvspemtlvlhlawvacgyiiwqnstedtwykmvkiqtvkqvqrnddfieldy
    tillhniasqeiipwqmqvlwhpqygtkvkhnsrlpk