PDB entry 2bo6

View 2bo6 on RCSB PDB site
Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
Class: transferase
Keywords: catalysis, glycosyltransferase, mannose, transferase, stereoselectivity
Deposited on 2005-04-08, released 2005-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.255
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bo6a_
  • Chain 'B':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bo6b_
  • Heterogens: DGY, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bo6A (A:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo6A (A:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bo6B (B:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo6B (B:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen