PDB entry 2bo4

View 2bo4 on RCSB PDB site
Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
Class: transferase
Keywords: catalysis, glycosyltransferase, mannose, transferase, stereoselectivity
Deposited on 2005-04-07, released 2005-06-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17683
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4a1
  • Chain 'B':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4b1
  • Chain 'C':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4c1
  • Chain 'D':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4d1
  • Chain 'E':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4e1
  • Chain 'F':
    Compound: mannosylglycerate synthase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bo4f1
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bo4A (A:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4A (A:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bo4B (B:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4B (B:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bo4C (C:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4C (C:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bo4D (D:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4D (D:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bo4E (E:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4E (E:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bo4F (F:)
    mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp
    vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf
    gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed
    ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl
    qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg
    lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy
    dyaqqylyrmlgryryqaalengrghpvppraalsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bo4F (F:)
    slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
    svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
    yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
    rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
    hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
    rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
    yaqqylyrmlgryryqaalen