PDB entry 2bo1

View 2bo1 on RCSB PDB site
Description: crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
Class: ribosomal protein
Keywords: ribosomal protein, ribonucleoprotein
Deposited on 2005-04-07, released 2006-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29160 (0-100)
      • engineered mutation (3)
      • engineered mutation (10-11)
      • engineered mutation (13)
      • engineered mutation (16-18)
      • engineered mutation (20)
      • engineered mutation (23-24)
      • engineered mutation (26-27)
      • engineered mutation (32)
      • engineered mutation (37)
      • engineered mutation (41)
      • engineered mutation (45)
      • engineered mutation (49)
      • engineered mutation (58)
      • engineered mutation (67)
      • engineered mutation (73-74)
      • engineered mutation (76)
      • engineered mutation (82-86)
      • engineered mutation (88)
    Domains in SCOPe 2.07: d2bo1a1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bo1A (A:)
    mvdiafelrkvidsgkytlgyrktvqslkmggskliiiarntrpdrkedleyyarlsgtp
    vyefegtnvelgtavgkphtvsvvsildagesrilalggke