PDB entry 2bo0

View 2bo0 on RCSB PDB site
Description: crystal structure of the c130a mutant of nitrite reductase from alcaligenes xylosoxidans
Class: oxidoreductase
Keywords: denitrification, nitrite reductase, c130a, mutant, electron transfer, oxidoreductase, copper, fad, flavoprotein, metal- binding, nitrate assimilation, periplasmic
Deposited on 2005-04-06, released 2006-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.108
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-335)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d2bo0a1, d2bo0a2
  • Heterogens: ZN, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bo0A (A:)
    edadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhaapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr