PDB entry 2bnz

View 2bnz on RCSB PDB site
Description: Structural basis for cooperative binding of Ribbon-Helix-Helix Omega repressor to inverted DNA heptad repeats
Class: DNA binding protein/DNA
Keywords: DNA binding protein-DNA complex, ribbon-helix-helix, rhh, metj/arc superfamily, cooperative DNA binding, inc18 family
Deposited on 2005-04-06, released 2006-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNZ
    • Uniprot Q57468 (Start-52)
    Domains in SCOPe 2.07: d2bnza_
  • Chain 'B':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNZ
    • Uniprot Q57468 (Start-52)
    Domains in SCOPe 2.07: d2bnzb_
  • Chain 'C':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNZ
    • Uniprot Q57468 (1-52)
    Domains in SCOPe 2.07: d2bnzc_
  • Chain 'D':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNZ
    • Uniprot Q57468 (Start-52)
    Domains in SCOPe 2.07: d2bnzd_
  • Chain 'E':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*gp*ap*tp*tp*ap*gp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: 5'-d(*cp*tp*ap*ap*tp*cp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*gp*ap*tp*tp*ap*gp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'H':
    Compound: 5'-d(*cp*tp*ap*ap*tp*cp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnzA (A:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnzA (A:)
    kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bnzB (B:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnzB (B:)
    kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bnzC (C:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnzC (C:)
    akkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bnzD (D:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnzD (D:)
    mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.