PDB entry 2bnz

View 2bnz on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix omega repressor to inverted DNA heptad repeats
Class: DNA binding protein/DNA
Keywords: ribbon-helix-helix, rhh, metj/arc superfamily, cooperative DNA binding, direct repeats, inverted repeats, DNA heptad 5'- a/t atcac a/t -3', inc18 family, plasmid, DNA-binding regulatory protein
Deposited on 2005-04-06, released 2006-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2BNZ (Start-17)
  • Uniprot Q57468 (Start-52)
  Domains in SCOP 1.75: d2bnza1
• Chain 'B':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2BNZ (Start-17)
  • Uniprot Q57468 (Start-52)
  Domains in SCOP 1.75: d2bnzb1
• Chain 'C':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2BNZ (Start-17)
  • Uniprot Q57468 (1-52)
  Domains in SCOP 1.75: d2bnzc1
• Chain 'D':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2BNZ (Start-17)
  • Uniprot Q57468 (Start-52)
  Domains in SCOP 1.75: d2bnzd1
• Chain 'E':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*gp*ap*tp*tp*ap*gp*c)-3'
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: 5'-d(*cp*tp*ap*ap*tp*cp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*gp*ap*tp*tp*ap*gp*c)-3'
  Species: synthetic, synthetic
  
• Chain 'H':
  Compound: 5'-d(*cp*tp*ap*ap*tp*cp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2bnzA (A:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bnzA (A:)
  kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2bnzB (B:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bnzB (B:)
  kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2bnzC (C:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bnzC (C:)
  akkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2bnzD (D:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bnzD (D:)
  mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.