PDB entry 2bnx

View 2bnx on RCSB PDB site
Description: crystal structure of the dimeric regulatory domain of mouse diaphaneous-related formin (drf), mdia1
Class: structural protein
Keywords: autoinhibition, actin, nucleation, cytoskeleton, structural protein
Deposited on 2005-04-05, released 2005-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19725
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bnxa1
  • Chain 'B':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bnxb1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnxA (A:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvdqmidktkvekseakatelekkldseltarhelq
    vemkkmendfeqklqdlqgekdalds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnxA (A:)
    srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
    keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
    llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
    itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
    dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi
    vlhkngtdpdfkcrhlqidierlvktkvekseakatel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bnxB (B:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvdqmidktkvekseakatelekkldseltarhelq
    vemkkmendfeqklqdlqgekdalds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnxB (B:)
    srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
    keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
    llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
    itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
    memddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh
    kngtdpdfkcrhlqidierlvdqmidktkvekseakate