PDB entry 2bnw

View 2bnw on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix omega repressor to direct DNA heptad repeats
Class: DNA-binding/regulatory protein
Keywords: DNA-binding-regulatory protein complex, ribbon-helix-helix, rhh, metj/arc superfamily, cooperative DNA binding, inverted repeats, DNA heptad, inc18 family, DNA-binding regulatory protein
Deposited on 2005-04-05, released 2006-03-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf omega
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNW
    • Uniprot Q57468 (Start-52)
    Domains in SCOPe 2.02: d2bnwa_
  • Chain 'B':
    Compound: orf omega
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNW (0-0)
    • Uniprot Q57468 (1-52)
    Domains in SCOPe 2.02: d2bnwb_
  • Chain 'C':
    Compound: orf omega
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNW (0-0)
    • Uniprot Q57468 (1-52)
    Domains in SCOPe 2.02: d2bnwc_
  • Chain 'D':
    Compound: orf omega
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNW
    • Uniprot Q57468 (Start-52)
    Domains in SCOPe 2.02: d2bnwd_
  • Chain 'E':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*tp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*tp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnwA (A:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnwA (A:)
    dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bnwB (B:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bnwC (C:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bnwD (D:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnwD (D:)
    mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.