PDB entry 2bno

View 2bno on RCSB PDB site
Description: structure of a zn enzyme
Class: oxidoreductase
Keywords: epoxidase,cupin,hth,cation-dependant,zinc,fosfomycin, oxidoreductase
Deposited on 2005-03-29, released 2005-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxidase
    Species: Streptomyces wedmorensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bnoa1, d2bnoa2
  • Chain 'B':
    Compound: epoxidase
    Species: Streptomyces wedmorensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bnob1, d2bnob2
  • Heterogens: HG, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnoA (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnoA (A:)
    tktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvl
    gtsigaltppagndlddgviiqmpderpilknvdyyvynclvrtkrapslvplvvdvltd
    npddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakg
    tgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bnoB (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnoB (B:)
    ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
    tsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdv
    ltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphafta
    akgtgsakliavnf