PDB entry 2bnn

View 2bnn on RCSB PDB site
Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
Class: oxidoreductase
Keywords: oxidoreductase, epoxidase, cupin, hth, cation-dependant, zinc, fosfomycin oxidoreductase
Deposited on 2005-03-29, released 2005-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bnna1, d2bnna2
  • Chain 'B':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bnnb1, d2bnnb2
  • Heterogens: FCN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnnA (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnnA (A:)
    ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
    tsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdv
    ltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphafta
    akgtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bnnB (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnnB (B:)
    ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
    tsigaltppagndlddgviiqmpderpilkgvyyvynclvrtkrapslvplvvdvltdnp
    ddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtg
    sakliavnf