PDB entry 2bnm

View 2bnm on RCSB PDB site
Description: structure of a zn enzyme
Class: oxidoreductase
Keywords: epoxidase,cupin,hth,cation-dependant, zinc, fosfomycin, oxidoreductase
Deposited on 2005-03-29, released 2005-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxidase
    Species: Streptomyces wedmorensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bnma1, d2bnma2
  • Chain 'B':
    Compound: epoxidase
    Species: Streptomyces wedmorensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bnmb1, d2bnmb2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnmA (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnmA (A:)
    ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
    tsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdv
    ltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphafta
    akgtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bnmB (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnmB (B:)
    ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
    tsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdv
    ltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphafta
    akgtgsakliavnf