PDB entry 2bnj

View 2bnj on RCSB PDB site
Description: The xylanase TA from Thermoascus aurantiacus utilizes arabinose decorations of xylan as significant substrate specificity determinants.
Class: hydrolase
Keywords: xylanase, glycosidase, hydrolase, pyrrolidone carboxylic acid, xylan degradation
Deposited on 2005-03-25, released 2005-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: THERMOASCUS AURANTIACUS [TaxId:5087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23360 (0-End)
      • conflict (192)
      • conflict (258)
      • conflict (299)
    Domains in SCOPe 2.08: d2bnja1
  • Heterogens: FER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bnjA (A:)
    eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
    fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
    gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
    ypktqaivnrvkkwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteldv
    agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
    lqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bnjA (A:)
    eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
    fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
    gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
    ypktqaivnrvkkwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteldv
    agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
    lq