PDB entry 2bne

View 2bne on RCSB PDB site
Description: the structure of e. coli ump kinase in complex with ump
Class: transferase
Keywords: transferase, nucleoside monophosphate kinase, pyrimidine biosynthesis
Deposited on 2005-03-23, released 2005-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2065
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNE
      • engineered mutation (158)
    • Uniprot P29464 (Start-240)
    Domains in SCOPe 2.05: d2bnea_
  • Chain 'B':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BNE
      • engineered mutation (158)
    • Uniprot P29464 (Start-240)
    Domains in SCOPe 2.05: d2bneb_
  • Heterogens: U5P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bneA (A:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bneA (A:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpptatmyeql
    tysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bneB (B:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bneB (B:)
    tnakpvykrillklsgealqgtefgidasildrmaqeikelvelgiqvgvvigggnlfrg
    aglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeai
    sllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatm
    yeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite