PDB entry 2bnd

View 2bnd on RCSB PDB site
Description: the structure of e.coli ump kinase in complex with udp
Class: transferase
Keywords: transferase, nucleoside monophosphate kinase, pyrimidine biosynthesis
Deposited on 2005-03-23, released 2005-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1948
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BND
      • conflict (111)
      • engineered mutation (158)
    • Uniprot P29464 (Start-240)
    Domains in SCOPe 2.05: d2bnda1
  • Chain 'B':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BND
      • conflict (111)
      • engineered mutation (158)
    • Uniprot P29464 (Start-240)
    Domains in SCOPe 2.05: d2bndb_
  • Heterogens: UDP, GOL, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bndA (A:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bndA (A:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
    eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bndB (B:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bndB (B:)
    nakpvykrillklsgealqgtefgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnavcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
    eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite