PDB entry 2bn0

View 2bn0 on RCSB PDB site
Description: banana lectin bound to laminaribiose
Class: lectin
Keywords: banana lectin, lectin, mannose-specific jacalin-related lectin
Deposited on 2005-03-17, released 2005-06-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bn0a_
  • Chain 'B':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bn0b_
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bn0A (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bn0B (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bn0B (B:)
    gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp
    heivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkis
    gffgrggkfldaigvylep