PDB entry 2bmz

View 2bmz on RCSB PDB site
Description: Banana Lectin bound to Xyl-b1,3 Man-a-O-Methyl (XM)
Class: sugar binding protein
Keywords: mannose-specific jacalin-related lectin, sugar binding protein
Deposited on 2005-03-17, released 2005-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bmza_
  • Chain 'B':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bmzb_
  • Heterogens: SO4, XLM, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bmzA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bmzB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmzB (B:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtph
    eivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkisg
    ffgrggkfldaigvylep