PDB entry 2bmv

View 2bmv on RCSB PDB site
Description: apoflavodoxin from helicobacter pylori
Class: electron transport
Keywords: electron transport, flavoprotein, helicobacter pylori, fmn, transport protein
Deposited on 2005-03-16, released 2006-06-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25776 (Start-163)
      • conflict, see remark (77)
      • conflict, see remark (116)
    Domains in SCOPe 2.01: d2bmva_
  • Heterogens: BEN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmvA (A:)
    mgkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdl
    qtdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdg
    yhfeaskaveggkfvglvidednqddltderiskwveqvkgsfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmvA (A:)
    gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
    tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
    hfeaskaveggkfvglvidednqddltderiskwveqvkgsfa