PDB entry 2bmu

View 2bmu on RCSB PDB site
Description: ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
Class: transferase
Keywords: ump kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase
Deposited on 2005-03-16, released 2005-07-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BMU
    • Uniprot Q8U122 (1-225)
    Domains in SCOPe 2.05: d2bmua_
  • Chain 'B':
    Compound: uridylate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BMU (0-0)
    • Uniprot Q8U122 (1-225)
    Domains in SCOPe 2.05: d2bmub_
  • Heterogens: ANP, U5P, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmuA (A:)
    amrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn
    ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght
    tdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekag
    sssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmuA (A:)
    mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
    setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
    davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
    ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bmuB (B:)
    amrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn
    ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght
    tdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekag
    sssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep