PDB entry 2bmr

View 2bmr on RCSB PDB site
Description: The Crystal Structure of Nitrobenzene Dioxygenase in complex with 3- nitrotoluene
Class: oxidoreductase
Keywords: nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron-sulfur, metal-binding, nad, oxidoreductase
Deposited on 2005-03-15, released 2005-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxygenase-alpha nbdo
    Species: COMAMONAS SP. [TaxId:58226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bmra1, d2bmra2
  • Chain 'B':
    Compound: oxygenase-beta nbdo
    Species: COMAMONAS SP. [TaxId:58226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bmrb_
  • Heterogens: FES, FE, 3NT, EDO, EOH, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmrA (A:)
    msyqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvd
    evivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfeke
    lygdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawyleptfkysgglel
    vgppgkvvvkanwksfaenfvgdgyhvgwthaaalragqsvfssiagnaklppegaglqm
    tskygsgmgvfwgyysgnfsadmipdlmafgaakqeklakeigdvrariyrsflngtifp
    nnsfltgsaafrvwnpidenttevwtyafvekdmpedlkrrvadavqrsigpagfwesdd
    nenmetmsqngkkyqssnidqiaslgfgkdvygdecypgvvgksaigetsyrgfyrayqa
    hisssnwaefenasrnwhiehtkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmrA (A:)
    yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
    ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
    gdaikkkclglkevpriesfhgfiygcfdaeapplidylgdaawyleptfkysgglelvg
    ppgkvvvkanwksfaenfvgdgyhvgwthaaalragqsvfssiagnaklppegaglqmts
    kygsgmgvfwgyysgnfsadmipdlmafgaakqeklakeigdvrariyrsflngtifpnn
    sfltgsaafrvwnpidenttevwtyafvekdmpedlkrrvadavqrsigpagfwesddne
    nmetmsqngkkyqssnidqiaslgfgkdvygdecypgvvgksaigetsyrgfyrayqahi
    sssnwaefenasrnwhi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bmrB (B:)
    mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
    eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
    tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
    peripqthnllvfl