PDB entry 2bmk

View 2bmk on RCSB PDB site
Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
Class: immune system
Keywords: catalytic antibody, transamination, pyridoxal-phosphate, hapten, phosphopyridoxyl-l-lysine, immune system
Deposited on 2005-03-14, released 2006-03-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2097
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BMK (27-212)
    Domains in SCOPe 2.03: d2bmka1, d2bmka2
  • Chain 'B':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.03: d2bmkb1, d2bmkb2
  • Chain 'H':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.03: d2bmkh1, d2bmkh2
  • Chain 'L':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BMK (27-212)
    Domains in SCOPe 2.03: d2bmkl1, d2bmkl2
  • Heterogens: IOD, PDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bmkA (A:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bmkB (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmkB (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bmkH (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmkH (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bmkL (L:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec