PDB entry 2bme

View 2bme on RCSB PDB site
Description: high resolution structure of gppnhp-bound human rab4a
Class: protein transport
Keywords: GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport
Deposited on 2005-03-13, released 2005-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab4a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bmea_
  • Chain 'B':
    Compound: ras-related protein rab4a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bmeb_
  • Chain 'C':
    Compound: ras-related protein rab4a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bmec_
  • Chain 'D':
    Compound: ras-related protein rab4a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bmed_
  • Heterogens: GNP, TRS, BME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmeA (A:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmeA (A:)
    setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
    wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
    kkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bmeB (B:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmeB (B:)
    etydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiw
    dtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnk
    kdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bmeC (C:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmeC (C:)
    setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
    wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
    kkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkies
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bmeD (D:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmeD (D:)
    setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
    wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
    kkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkies