PDB entry 2bmd

View 2bmd on RCSB PDB site
Description: high resolution structure of GDP-bound human rab4a
Class: protein transport
Keywords: GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport
Deposited on 2005-03-13, released 2005-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab4a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BMD
    • Uniprot P20338 (Start-185)
    Domains in SCOPe 2.05: d2bmda1
  • Heterogens: GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmdA (A:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmdA (A:)
    etydflfkflvignagtgkscllhqfiekkfkefgskiinvggkyvklqiwdtagqerfr
    svtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkdldadrev
    tfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgeldpermg