PDB entry 2bm7

View 2bm7 on RCSB PDB site
Description: the structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.
Class: pentapeptide repeat protein
Keywords: pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry, right-handed quadrilateral beta-helix
Deposited on 2005-03-09, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentapeptide repeat family protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bm7a_
  • Chain 'B':
    Compound: pentapeptide repeat family protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BM7
    • Uniprot O50390 (Start-185)
    Domains in SCOPe 2.08: d2bm7b_
  • Chain 'C':
    Compound: pentapeptide repeat family protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BM7
    • Uniprot O50390 (Start-185)
    Domains in SCOPe 2.08: d2bm7c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bm7A (A:)
    gshmqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctfert
    tlwhstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdt
    dlrkcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahg
    lclagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm7A (A:)
    qwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhs
    tfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkc
    vlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bm7B (B:)
    gshmqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctfert
    tlwhstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdt
    dlrkcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahg
    lclagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm7B (B:)
    qwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhs
    tfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkc
    vlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclag
    g
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bm7C (C:)
    gshmqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctfert
    tlwhstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdt
    dlrkcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahg
    lclagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm7C (C:)
    wvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhst
    faqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkcv
    lrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclagg