PDB entry 2bm5

View 2bm5 on RCSB PDB site
Description: the structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.
Class: pentapeptide repeat protein
Keywords: pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry, right-handed quadrilateral beta-helix
Deposited on 2005-03-09, released 2005-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentapeptide repeat family protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BM5
    • Uniprot O50390 (3-185)
    Domains in SCOPe 2.06: d2bm5a_
  • Chain 'B':
    Compound: pentapeptide repeat family protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BM5
    • Uniprot O50390 (3-End)
    Domains in SCOPe 2.06: d2bm5b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bm5A (A:)
    gshmqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctfert
    tlwhstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdt
    dlrkcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahg
    lclagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm5A (A:)
    mqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlw
    hstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlr
    kcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcl
    agg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bm5B (B:)
    gshmqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctfert
    tlwhstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdt
    dlrkcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahg
    lclagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm5B (B:)
    mqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlw
    hstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlr
    kcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcl
    a