PDB entry 2bm3

View 2bm3 on RCSB PDB site
Description: structure of the type II cohesin from clostridium thermocellum sdba
Class: nuclear protein
Keywords: cohesin, type 2, cellulosome, dockerin, nuclear protein
Deposited on 2005-03-09, released 2005-03-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19212
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scaffolding dockerin binding protein a
    Species: Clostridium thermocellum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bm3a1
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bm3A (A:)
    masdkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgke
    ftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiaki
    gfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm3A (A:)
    kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
    tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
    lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpd