PDB entry 2bm1

View 2bm1 on RCSB PDB site
Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant g16v
Class: elongation factor
Keywords: switch II, elongation factor, GTP-binding, mutation gly16val, protein biosynthesis, translation
Deposited on 2005-03-09, released 2005-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551
      • engineered mutation (15)
    Domains in SCOPe 2.07: d2bm1a1, d2bm1a2, d2bm1a3, d2bm1a4, d2bm1a5
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bm1A (A:)
    mavkveydlkrlrniviaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm1A (A:)
    kveydlkrlrniviaahidagktttterilyytgriitaavttcfwkdhriniidtpghv
    dftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwl
    virtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldq
    areyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkg
    vqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfi
    rvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdt
    lvgedaprvilesievpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgq
    tiisgmgelhleiivdrlkrefkvdanvgkpqvayretitkpvdvegkfirqtggrgqyg
    hvkikveplprgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtly
    dgsyhevdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarr
    gqilgmeprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqekli