PDB entry 2bm0

View 2bm0 on RCSB PDB site
Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant t84a
Class: elongation factor
Keywords: switch II, elongation factor, GTP-binding, translation mutation thr84ala, protein biosynthesis
Deposited on 2005-03-09, released 2005-05-04
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551
      • conflict (42)
      • engineered mutation (83)
    Domains in SCOP 1.75: d2bm0a1, d2bm0a2, d2bm0a3, d2bm0a4, d2bm0a5
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bm0A (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkiaevhegaatmdfmeqere
    rgititaavttcfwkdhriniidapghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bm0A (A:)
    kveydlkrlrnigiaahidagktttterilyytgrihkiatitaavttcfwkdhriniid
    apghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktg
    adlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipe
    eyldqareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsa
    lknkgvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvg
    rltfirvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglket
    itgdtlvgedaprvilesievpepvidvaiepktkadqeklsqalarlaeedptfrvsth
    petgqtiisgmgelhleiivdrlkrefkvdanvgkpqvayretitkpvdvegkfirqtgg
    rgqyghvkikveplprgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdi
    kvtlydgsyhevdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigd
    lnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqv
    qeklik