PDB entry 2blu

View 2blu on RCSB PDB site
Description: Thaumatin After A High Dose X-Ray "Burn"
Class: plant protein
Keywords: radiation damage, synchrotron, phasing, rip, plant protein, taste-modifying protein
Deposited on 2005-03-08, released 2005-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2blua_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bluA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpt