PDB entry 2bln

View 2bln on RCSB PDB site
Description: n-terminal formyltransferase domain of arna in complex with n-5-formyltetrahydrofolate and ump
Class: transferase
Keywords: transferase, formyltransferase, l-ara4n biosynthesis, methyltransferase
Deposited on 2005-03-07, released 2005-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.136
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein yfbg
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2blna1, d2blna2
  • Chain 'B':
    Compound: protein yfbg
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2blnb1, d2blnb2
  • Heterogens: FON, U5P, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2blnA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2blnA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdfygsvarlaaergipvyapdnvnhpl
    wveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnget
    etgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnil
    eiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssr
    vhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2blnB (B:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2blnB (B:)
    mktvvfayhdmgclgieallaagyeisaifthtdfygsvarlaaergipvyapdnvnhpl
    wveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnget
    etgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnil
    eiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssr
    vhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl