PDB entry 2bll

View 2bll on RCSB PDB site
Description: apo-structure of the c-terminal decarboxylase domain of arna
Class: transferase
Keywords: decarboxylase, short chain dehydrogenase, l-ara4n biosynthesis, methyltransferase, transferase
Deposited on 2005-03-07, released 2005-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein yfbg
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2blla1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bllA (A:)
    mrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsew
    ieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsev
    ygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmg
    prldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienag
    nrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqd
    vehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bllA (A:)
    mrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsew
    ieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsev
    ygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmg
    prldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienag
    nrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvvehrkpsirnah
    rcldwepkidmqetidetldfflrtvdltd