PDB entry 2bli

View 2bli on RCSB PDB site
Description: L29W Mb deoxy
Class: oxygen transport
Keywords: myoglobin, mutant, oxygen transport, heme
Deposited on 2005-03-04, released 2005-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • see remark 999 (121)
    Domains in SCOPe 2.07: d2blia_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bliA (A:)
    vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyqg