PDB entry 2blh

View 2blh on RCSB PDB site
Description: ligand migration and protein fluctuations in myoglobin mutant l29w
Class: oxygen transport
Keywords: myoglobin, mutant, oxygen transport, heme
Deposited on 2005-03-04, released 2005-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.1865
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
    • engineered mutation (28)
    • see remark 999 (121)
  Domains in SCOPe 2.04: d2blha_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2blhA (A:)
  vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gnfgadaqgamnkalelfrkdiaakykelgyqg