PDB entry 2blh

View 2blh on RCSB PDB site
Description: ligand migration and protein fluctuations in myoglobin mutant l29w
Class: oxygen transport
Keywords: myoglobin, mutant, oxygen transport, heme
Deposited on 2005-03-04, released 2005-04-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.1865
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
    • engineered mutation (28)
    • see remark 999 (121)
  Domains in SCOP 1.73: d2blha1
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2blhA (A:)
  vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gnfgadaqgamnkalelfrkdiaakykelgyqg