PDB entry 2bl8

View 2bl8 on RCSB PDB site
Description: 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
Class: bacterial protein
Keywords: enterocin a, orf2 protein, immunity, bacterial protein
Deposited on 2005-03-02, released 2005-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterocine a immunity protein
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bl8a1
  • Chain 'B':
    Compound: enterocine a immunity protein
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bl8b_
  • Chain 'C':
    Compound: enterocine a immunity protein
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bl8c_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bl8A (A:)
    mkknakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyf
    taytnkirfteyqeelirnlseigrtaginglyradygdksqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl8A (A:)
    nakqivhelyndisiskdpkysdilevlqkvylklepsplinrlvnylyftaytnkirft
    eyqeelirnlseigrtaginglyradygdksqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bl8B (B:)
    mkknakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyf
    taytnkirfteyqeelirnlseigrtaginglyradygdksqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl8B (B:)
    nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
    tnkirfteyqeelirnlseigr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bl8C (C:)
    mkknakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyf
    taytnkirfteyqeelirnlseigrtaginglyradygdksqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl8C (C:)
    nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
    tnkirfteyqeelirnlslyradygdksqf