PDB entry 2bl7

View 2bl7 on RCSB PDB site
Description: 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
Class: immune system
Keywords: immune system, enterocin a, orf2 protein, immunity, bacterial protein
Deposited on 2005-03-02, released 2005-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2097
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterocine a immunity protein
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47785
      • engineered mutation (30)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d2bl7a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bl7A (A:)
    mkknakqivhelyndisiskdpkysdilevmqkvylklekqkyeldpsplinrlvnylyf
    taytnkirfteyqeelirnmseigrtaginglyradygdksqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl7A (A:)
    knakqivhelyndisiskdpkysdilevmqkvylklekqkyeldpsplinrlvnylyfta
    ytnkirfteyqeelirnmse