SCOP 1.73: Structural Classification of Proteins

PDB entry 2bl5

View 2bl5 on RCSB PDB site
Description: solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
Class: RNA binding
Keywords: star proteins, gsg proteins, quaking, RNA binding
Deposited on 2005-03-01, released 2005-04-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-14, with a file datestamp of 2007-07-20.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: mgc83862 protein
Species: Xenopus laevis
Database cross-references and differences (RAF-indexed):
- Uniprot Q6IRN2 (0-133)
- PDB 2BL5 (134-End)
Domains in SCOP 1.73: d2bl5a1

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2bl5A (A:)
qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
ngtyrdanlkspalhhhhhh

Sequence, based on observed residues (ATOM records): (download)

>2bl5A (A:)
qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
ngtyrdanlkspalh