PDB entry 2bl5

View 2bl5 on RCSB PDB site
Description: solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
Class: RNA binding
Keywords: star proteins, gsg proteins, quaking, RNA binding
Deposited on 2005-03-01, released 2005-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mgc83862 protein
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IRN2 (0-133)
    • PDB 2BL5 (134-End)
    Domains in SCOPe 2.08: d2bl5a1, d2bl5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bl5A (A:)
    qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
    kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
    ngtyrdanlkspalhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl5A (A:)
    qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
    kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
    ngtyrdanlkspalh