PDB entry 2bl1

View 2bl1 on RCSB PDB site
Description: crystal structure of a putative phosphinothricin acetyltransferase (pa4866) from pseudomonas aeruginosa pac1
Class: transferase
Keywords: gnat, n-acetyltransferase, hypothetical protein, phosphinothricin, gcn5 family, pseudomonas aeruginosa, transferase
Deposited on 2005-02-24, released 2005-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1974
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphinothricin n-acetyltransferase pa4866
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • variant (46)
    Domains in SCOPe 2.06: d2bl1a1
  • Heterogens: AZI, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bl1A (A:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bl1A (A:)
    asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
    gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
    iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap