PDB entry 2bl0

View 2bl0 on RCSB PDB site
Description: physarum polycephalum myosin II regulatory domain
Class: muscle protein
Keywords: muscle protein, slime mould, ef-hand, myosin
Deposited on 2005-02-23, released 2005-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major plasmodial myosin heavy chain
  Species: Physarum polycephalum [TaxId:5791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BJD3 (0-62)
• Chain 'B':
  Compound: myosin regulatory light chain
  Species: Physarum polycephalum [TaxId:5791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08053 (0-144)
• Chain 'C':
  Compound: myosin regulatory light chain
  Species: Physarum polycephalum [TaxId:5791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WSQ4 (0-141)
  Domains in SCOPe 2.07: d2bl0c_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bl0C (C:)
  gddqvsefkeafelfdsertgfitkeglqtvlkqfgvrvepaafnemfneadatgngkiq
  fpeflsmmgrrmkqttsedilrqafrtfdpegtgyipkaalqdallnlgdrlkphefaef
  lgitetekgqirydnfintmft