PDB entry 2bl0

View 2bl0 on RCSB PDB site
Description: physarum polycephalum myosin II regulatory domain
Class: muscle protein
Keywords: muscle protein, slime mould, ef-hand, myosin
Deposited on 2005-02-23, released 2005-10-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major plasmodial myosin heavy chain
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: myosin regulatory light chain
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bl0c_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bl0C (C:)
    gddqvsefkeafelfdsertgfitkeglqtvlkqfgvrvepaafnemfneadatgngkiq
    fpeflsmmgrrmkqttsedilrqafrtfdpegtgyipkaalqdallnlgdrlkphefaef
    lgitetekgqirydnfintmft